PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2659300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family BES1
Protein Properties Length: 699aa    MW: 78511.2 Da    PI: 4.8513
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2659300.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822150.21.7e-46762161135
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpl..eeaeaagssasas 89 
                      gg++r+++ +E+E++k+RERrRRai+a+i+aGLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++   +g++p   ++a ++ ss+  s
  Lj1g3v2659300.1  76 GGARRSRPLEEKERTKLRERRRRAITARILAGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPsrsQGQRPDggNSAPVTSSSQVPS 169
                      6899*****************************************************************9878888888744444555555577 PP

           DUF822  90 pesslq.sslkssalaspvesysaspksssfpspssldsislasaas 135
                      +++++  ++ ++s   sp+e  ++++k + +p+ps +d  s++ +++
  Lj1g3v2659300.1 170 QQTPSAsLRGVASGYGSPLEYNACQMKGVFMPAPSPYDLSSSSRSQT 216
                      7877776889999*************************998775544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.1E-4078212IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514456.14E-182258694IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.801.2E-196259693IPR013781Glycoside hydrolase, catalytic domain
PfamPF013737.9E-103265684IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-69296310IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-69317335IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-69339360IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-69432454IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-69505524IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-69539555IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-69556567IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-69574597IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.3E-69614636IPR001554Glycoside hydrolase, family 14
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MATDMQRFVG TSEDDEEMGM GVKDEDEDDD DYDENGEDGN APGMIEIDDG NGIQTAPGDN  60
RFQQHQQFQE LEEPGGGARR SRPLEEKERT KLRERRRRAI TARILAGLRR HGNYNLRVRA  120
DINDVIAALA REAGWVVLPD GTTFPSRSQG QRPDGGNSAP VTSSSQVPSQ QTPSASLRGV  180
ASGYGSPLEY NACQMKGVFM PAPSPYDLSS SSRSQTSIVG DGETQRDNIP GIGGSMNSVD  240
EKQIADMPPR LPERDLAGTP YVPVYVMLPL GVINIKCELV DPDGLLKQLR VLKSINVDGV  300
MVDCWWGIVE AHAPQEYNWN GYKRLFQMVR ELKLKLQVLM SFHECGGNFG DDVCIPLPHW  360
VAEIGRSNPD IFFTDREGRH NPECLSWGID KERVLRGRTA VEVYFDFMRS FRVEFDEYFE  420
DGFISMIEVG LGPCGELRYP SCPVKHGWRY PGIGEFQCYD QYMLKSLRKA AEIRGHSIWA  480
RGPDNVGTYN SQPHETGFFC DGGDYDSFYG RFFLNWYSQV LVDHGNRVLS LAKLAFEGSC  540
IAAKLSGIYW WYKTASHAAE LTAGYYNPCN RDGYASIMTM LKRNGVSLNI PCVDLQTLNQ  600
HEGFPETFAD PEGLVWQVLN AGWDVGLPVV SENALPCLNR VSYNKVLDNA KPMNDPDGRH  660
FSSFAYPRLS PLLMERQNFI EFERFVKRMH GEAVLDLQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1byd_A1e-14526169211444BETA-AMYLASE
1byc_A1e-14526169211444BETA-AMYLASE
1byb_A1e-14526169211444BETA-AMYLASE
1bya_A1e-14526169211444BETA-AMYLASE
1wds_A1e-14526169211444Beta-amylase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0097790.0AP009779.1 Lotus japonicus genomic DNA, clone: LjT34L14, TM1967, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497679.10.0PREDICTED: beta-amylase 7 isoform X2
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLA0A0L9TBI90.0A0A0L9TBI9_PHAAN; Beta-amylase
STRINGGLYMA18G46630.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108833339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7